General Information

  • ID:  hor006567
  • Uniprot ID:  Q09628
  • Protein name:  Probable insulin-like peptide beta-type 3
  • Gene name:  ins-3
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0040024 dauer larval development; GO:1905910 negative regulation of dauer entry
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GDKVKICGTKVLKMVMVMCGGECSSTNENIATECCEKMCTMEDITTKCCPSR
  • Length:  52
  • Propeptide:  MKLSVVLALFIIFQLGAASLMRNWMFDFEKELEHDYDDSEIGFHNIHSLMARSRRGDKVKICGTKVLKMVMVMCGGECSSTNENIATECCEKMCTMEDITTKCCPSR
  • Signal peptide:  MKLSVVLALFIIFQLGAAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-35; 19-48; 23-49; 34-39
  • Structure ID:  AF-Q09628-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006567_AF2.pdbhor006567_ESM.pdb

Physical Information

Mass: 655160 Formula: C225H389N63O78S13
Absent amino acids: FHQWY Common amino acids: C
pI: 6.24 Basic residues: 7
Polar residues: 23 Hydrophobic residues: 9
Hydrophobicity: -7.31 Boman Index: -7521
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.23
Instability Index: 6387.12 Extinction Coefficient cystines: 500
Absorbance 280nm: 9.8

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.